PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 519aa    MW: 55516.4 Da    PI: 9.8022
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009051.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.5e-12385443563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr +r   NR++A +s +RK +++ eLe +v +L+ e + L ++l   + e+++lk+++
  Do009051.1 385 KRVKRILANRVSAAKSKERKAKYMGELEHRVHVLQMETSNLSSKLVLSQRECEALKTQN 443
                 899*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-14381445IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082383446IPR004827Basic-leucine zipper domain
PfamPF001702.2E-10385443IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-11385442No hitNo description
SuperFamilySSF579591.38E-10385441No hitNo description
CDDcd147031.28E-18386437No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MDEDRSAHPA RRTRLLSPPS GQPQVPRTSS LPLDLSLPMD LSSQYQRSVP PRAATMDEDR  60
SAHPMHRARL LSPPSGQPQA PRAPSLPMDL SLPMDLSSQY QRHYAQSLLP PMGPRLTSSS  120
GFSAFSNYQG PPALSPAPAG GSHLALARSL LKPSFFSTDS LAPHPYSADP ATGASAAVQC  180
SPTPLGSEER GTSASGLPPR GAGHRRSRSD FLVGFSLQNQ LPLPALPAAE GYSKSANATA  240
LEELFRSYSD TRALGMLGSS HLGNQVNSQR AWSPVDSSDN EAESWATGGG RRGCTSHPRH  300
CRSLSVDSFM GSLNFGGLGQ VPPTLPPPSP ASGAGGGLSH TVSRPSGSAT AVATSELANG  360
AFTEPEMKKI MANNRLAEIA LSDPKRVKRI LANRVSAAKS KERKAKYMGE LEHRVHVLQM  420
ETSNLSSKLV LSQRECEALK TQNNEMKIRL QALEQQAQLK NALNQALGAE VELLKQAVCE  480
ASDAHAPNGS HHHMNRQILE QQLLQLQKLP SDAQKAQQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699390.10.0PREDICTED: transcription factor RF2a-like
TrEMBLK4A0W60.0K4A0W6_SETIT; Uncharacterized protein
STRINGSi032507m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-38bZIP family protein